PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G06890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MIKC_MADS
Protein Properties Length: 253aa    MW: 28696.3 Da    PI: 5.3976
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G06890.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.61.2e-263684351
                     --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     ie++  rqvtf+kR ng+lKKA+ELS LCdaeva+i+fss+g+lyeys+
  OGLUM05G06890.1 36 IEDTADRQVTFCKRCNGLLKKAYELSMLCDAEVALIVFSSRGRLYEYSN 84
                     99*********************************************95 PP

2K-box47.95.8e-171021964100
            K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLsl.keLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                      s+ + ++e +a+++qqe+akLk+ i  Lq+++R ++  +L+ L++  +L ++  +L  +l+kiR++Kne+l+++ie++q++e elq++n++ ++
  OGLUM05G06890.1 102 SNASTVAEINAQHYQQEAAKLKQHITYLQNSNRFII--SLSCLDFfFQLDKVV-HLVIGLEKIRARKNEYLCAEIEYMQRRETELQNDNMYSKS 192
                      34444999**********************977765..788777524666664.5889********************************9999 PP

            K-box  97 klee 100
                      +++e
  OGLUM05G06890.1 193 EVAE 196
                      8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.3E-232685IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.9642686IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-222848IPR002100Transcription factor, MADS-box
PfamPF003195.1E-243682IPR002100Transcription factor, MADS-box
CDDcd002658.48E-3436100No hitNo description
SuperFamilySSF554555.1E-253699IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-224863IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-226384IPR002100Transcription factor, MADS-box
PfamPF014866.0E-10111189IPR002487Transcription factor, K-box
PROSITE profilePS512977.795112200IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MHIYKEQEAE PSTGLMMPEP APAASPGSGS SDGSGIEDTA DRQVTFCKRC NGLLKKAYEL  60
SMLCDAEVAL IVFSSRGRLY EYSNNSVEET IERYKKANSD TSNASTVAEI NAQHYQQEAA  120
KLKQHITYLQ NSNRFIISLS CLDFFFQLDK VVHLVIGLEK IRARKNEYLC AEIEYMQRRE  180
TELQNDNMYS KSEVAESERG LQTVNMMGSA STSEYVQNMI HYDPGNFLQF NIMQQLASLS  240
IILNRRTERP HSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-153494969Myocyte-specific enhancer factor 2B
1tqe_Q4e-153494969Myocyte-specific enhancer factor 2B
1tqe_R4e-153494969Myocyte-specific enhancer factor 2B
1tqe_S4e-153494969Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2321571e-128AB232157.1 Oryza sativa Japonica Group mRNA for transcription factor OsMADS58, complete cds.
GenBankAK1117231e-128AK111723.1 Oryza sativa Japonica Group cDNA clone:J023027E19, full insert sequence.
GenBankFJ7509421e-128FJ750942.1 Oryza sativa clone KCS268A08 MADS-box transcription factor 58 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015638060.11e-124PREDICTED: MADS-box transcription factor 58
SwissprotQ2V0P11e-127MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBLA0A0D9ZVH90.0A0A0D9ZVH9_9ORYZ; Uncharacterized protein
STRINGLOC_Os05g11414.11e-125(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64937144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.16e-67MIKC_MADS family protein